TDO2 Polyclonal AntibodyTDO2 Polyclonal Antibody
Move your mouse over image or click to enlarge

TDO2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13182-200ul 200ul
£332.50
A13182-100ul 100ul
£192.50
A13182-50ul 50ul
£113.75
A13182-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13182
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TDO2; TDO; TO; TPH2; TRPO; tryptophan 2,3-dioxygenase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-260 of human TDO2 (NP_005642.1).
Reactivity Human, Mouse, Rat
Gene ID 6999
Calculated MW 47kDa
Observed MW 48kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQ
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents