TCEAL2 Polyclonal AntibodyTCEAL2 Polyclonal Antibody
Move your mouse over image or click to enlarge

TCEAL2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13184-200ul 200ul
£332.50
A13184-100ul 100ul
£192.50
A13184-50ul 50ul
£113.75
A13184-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13184
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TCEAL2; MY0876G05; WEX1; my048; transcription elongation factor A like 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TCEAL2 (NP_525129.1).
Reactivity Mouse
Gene ID 140597
Calculated MW 25kDa
Observed MW 26kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEKLFNENEGMPSNQGKIDNEEQPPHEGKPEVACILEDKKLENEGNTENTGKRVEEPLKDKEKPESAGKAKGEGKSERKGKSEMQGGSKTEGKPERGGRAEGEGEPDSER
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents