TBX3 Polyclonal AntibodyTBX3 Polyclonal Antibody
Move your mouse over image or click to enlarge

TBX3 Polyclonal Antibody

Cat# Size Price Qty Buy
A4144-200ul 200ul
£332.50
A4144-100ul 100ul
£192.50
A4144-50ul 50ul
£113.75
A4144-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4144
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TBX3; TBX3-ISO; UMS; XHL; T-box 3
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 246-385 of human TBX3 (NP_057653.3).
Reactivity Human, Mouse
Gene ID 6926
Calculated MW 65kDa/77kDa/79kDa
Observed MW 79kDa
Physical Appearance liquid
Purification Affinity purification
Sequence HKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQLTLQSMRVFDERHKKENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEH
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents