SYT17 Polyclonal AntibodySYT17 Polyclonal Antibody
Move your mouse over image or click to enlarge

SYT17 Polyclonal Antibody

Cat# Size Price Qty Buy
A4764-200ul 200ul
£332.50
A4764-100ul 100ul
£192.50
A4764-50ul 50ul
£113.75
A4764-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4764
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SYT17; sytXVII; synaptotagmin-17
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 125-474 of human SYT17 (NP_057608.2).
Reactivity Mouse, Rat
Gene ID 51760
Calculated MW 53kDa
Observed MW 54kDa
Physical Appearance liquid
Purification Affinity purification
Sequence KPIEFGVLSAKKEPIQPSVLRRTYNPDDYFRKFEPHLYSLDSNSDDVDSLTDEEILSKYQLGMLHFSTQYDLLHNHLTVRVIEARDLPPPISHDGSRQDMAHSNPYVKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVSVPLCEVDLVKGGHWWKALIPSSQNEVELGELLLSLNYLPSAGRLNVDVIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKTKKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDFIGRIVIGQYSSGPSETNHWRRMLNTHRTAVEQWHSLRSRAECDRVSPASLEVT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents