SYF2 Polyclonal AntibodySYF2 Polyclonal Antibody
Move your mouse over image or click to enlarge

SYF2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14396-200ul 200ul
£332.50
A14396-100ul 100ul
£192.50
A14396-50ul 50ul
£113.75
A14396-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14396
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SYF2; CBPIN; NTC31; P29; fSAP29; pre-mRNA-splicing factor SYF2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-243 of human SYF2 (NP_056299.1).
Reactivity Mouse
Gene ID 25949
Calculated MW 23kDa/28kDa
Observed MW 29kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents