SYCP2 Polyclonal AntibodySYCP2 Polyclonal Antibody
Move your mouse over image or click to enlarge

SYCP2 Polyclonal Antibody

Cat# Size Price Qty Buy
A16098-20ul 20ul
£77.00
A16098-50ul 50ul
£113.75
A16098-100ul 100ul
£192.50
A16098-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16098
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SYCP2; SCP-2; SCP2; synaptonemal complex protein 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1231-1530 of human SYCP2 (NP_055073.2).
Reactivity Human, Mouse, Rat
Gene ID 10388
Calculated MW 175kDa
Observed MW 176kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EIESPHINENYIQSKREESHLASSLSKSSEGREKTWFDMPCDATHVSGPTQHLSRKRIYIEDNLSNSNEVEMEEKGERRANLLPKKLCKIEDADHHIHKMSESVSSLSTNDFSIPWETWQNEFAGIEMTYETYERLNSEFKRRNNIRHKMLSYFTTQSWKTAQQHLRTMNHQSQDSRIKKLDKFQFIIIEELENFEKDSQSLKDLEKEFVDFWEKIFQKFSAYQKSEQQRLHLLKTSLAKSVFCNTDSEETVFTSEMCLMKEDMKVLQDRLLKDMLEEELLNVRRELMSVFMSHERNANV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents