SUMF1 Polyclonal AntibodySUMF1 Polyclonal Antibody
Move your mouse over image or click to enlarge

SUMF1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14463-200ul 200ul
£332.50
A14463-100ul 100ul
£192.50
A14463-50ul 50ul
£113.75
A14463-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14463
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SUMF1; AAPA3037; FGE; UNQ3037; sulfatase-modifying factor 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 34-374 of human SUMF1 (NP_877437.2).
Reactivity Mouse, Rat
Gene ID 285362
Calculated MW 31kDa/37kDa/38kDa/40kDa/46kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence SQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents