SULT2A1 Polyclonal AntibodySULT2A1 Polyclonal Antibody
Move your mouse over image or click to enlarge

SULT2A1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14063-200ul 200ul
£332.50
A14063-100ul 100ul
£192.50
A14063-50ul 50ul
£113.75
A14063-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14063
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SULT2A1; DHEA-ST; DHEAS; HST; ST2; ST2A1; ST2A3; STD; hSTa; bile salt sulfotransferase
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human SULT2A1 (NP_003158.2).
Reactivity Human, Mouse, Rat
Gene ID 6822
Calculated MW 33kDa
Observed MW 34kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKS
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents