SULT1A1 Polyclonal AntibodySULT1A1 Polyclonal Antibody
Move your mouse over image or click to enlarge

SULT1A1 Polyclonal Antibody

Cat# Size Price Qty Buy
A1599-20ul 20ul
£77.00
A1599-50ul 50ul
£113.75
A1599-100ul 100ul
£192.50
A1599-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A1599
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SULT1A1; HAST1/HAST2; P-PST; PST; ST1A1; ST1A3; STP; STP1; TSPST1; sulfotransferase 1A1
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-295 of human SULT1A1 (NP_803565.1).
Reactivity Human, Mouse, Rat
Gene ID 6817
Calculated MW 25kDa/34kDa
Observed MW 34kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents