SUGT1 Polyclonal AntibodySUGT1 Polyclonal Antibody
Move your mouse over image or click to enlarge

SUGT1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13908-200ul 200ul
£332.50
A13908-100ul 100ul
£192.50
A13908-50ul 50ul
£113.75
A13908-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13908
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SUGT1; SGT1; protein SGT1 homolog
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 159-333 of human SUGT1 (NP_006695.1).
Reactivity Human, Mouse, Rat
Gene ID 10910
Calculated MW 37kDa/41kDa
Observed MW 38kDa/41kDa
Physical Appearance liquid
Purification Affinity purification
Sequence NVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents