STX10 Polyclonal AntibodySTX10 Polyclonal Antibody
Move your mouse over image or click to enlarge

STX10 Polyclonal Antibody

Cat# Size Price Qty Buy
A13827-200ul 200ul
£332.50
A13827-100ul 100ul
£192.50
A13827-50ul 50ul
£113.75
A13827-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13827
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names STX10; SYN10; hsyn10; syntaxin-10
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 76-165 of human STX10 (NP_001258540.1).
Reactivity Human
Gene ID 8677
Calculated MW 22kDa/28kDa
Observed MW 35kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLR
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents