STMN1 Polyclonal AntibodySTMN1 Polyclonal Antibody
Move your mouse over image or click to enlarge

STMN1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14018-200ul 200ul
£332.50
A14018-100ul 100ul
£192.50
A14018-50ul 50ul
£113.75
A14018-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14018
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names STMN1; C1orf215; LAP18; Lag; OP18; PP17; PP19; PR22; SMN; stathmin
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-149 of human STMN1 (NP_981944.1).
Reactivity Human, Mouse
Gene ID 3925
Calculated MW 17kDa/19kDa
Observed MW 20kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents