STING / TMEM173 Polyclonal AntibodySTING / TMEM173 Polyclonal Antibody
Move your mouse over image or click to enlarge

STING / TMEM173 Polyclonal Antibody

Cat# Size Price Qty Buy
A3575-200ul 200ul
£332.50
A3575-100ul 100ul
£192.50
A3575-50ul 50ul
£113.75
A3575-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3575
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TMEM173; ERIS; MITA; MPYS; NET23; SAVI; STING; hMITA; hSTING; transmembrane protein 173
Applications IHC, IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 170-379 of human STING / TMEM173 (NP_938023.1).
Reactivity Human, Mouse
Gene ID 340061
Calculated MW 42kDa
Observed MW 39kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100|IP,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents