STAU2 Polyclonal AntibodySTAU2 Polyclonal Antibody
Move your mouse over image or click to enlarge

STAU2 Polyclonal Antibody

Cat# Size Price Qty Buy
A3413-200ul 200ul
£332.50
A3413-100ul 100ul
£192.50
A3413-50ul 50ul
£113.75
A3413-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3413
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names STAU2; 39K2; 39K3; staufen double-stranded RNA binding protein 2
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human STAU2 (NP_001157852.1).
Reactivity Human, Mouse, Rat
Gene ID 27067
Calculated MW 11kDa/34kDa/43kDa/52kDa/55kDa/59kDa/62kDa
Observed MW 52kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PEYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPKPG
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents