STAU1 Polyclonal AntibodySTAU1 Polyclonal Antibody
Move your mouse over image or click to enlarge

STAU1 Polyclonal Antibody

Cat# Size Price Qty Buy
A4131-200ul 200ul
£332.50
A4131-100ul 100ul
£192.50
A4131-50ul 50ul
£113.75
A4131-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4131
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names STAU1; PPP1R150; STAU; staufen double-stranded RNA binding protein 1
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 426-577 of human STAU1 (NP_059347.2).
Reactivity Human, Mouse, Rat
Gene ID 6780
Calculated MW 54kDa/55kDa/63kDa
Observed MW 58kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QAVGVSQGHHTKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGHVPHGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCGRC
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents