STARD4 Polyclonal AntibodySTARD4 Polyclonal Antibody
Move your mouse over image or click to enlarge

STARD4 Polyclonal Antibody

Cat# Size Price Qty Buy
A15955-20ul 20ul
£77.00
A15955-50ul 50ul
£113.75
A15955-100ul 100ul
£192.50
A15955-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15955
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names STARD4; stAR-related lipid transfer protein 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human STARD4 (NP_001294986.1).
Reactivity Mouse, Rat
Gene ID 134429
Calculated MW 18kDa/23kDa
Observed MW 24kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHIRPGPCRLDWDSLMTSLDILENFEENCCVMR
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents