STAMBPL1 Polyclonal AntibodySTAMBPL1 Polyclonal Antibody
Move your mouse over image or click to enlarge

STAMBPL1 Polyclonal Antibody

Cat# Size Price Qty Buy
A15877-20ul 20ul
£77.00
A15877-50ul 50ul
£113.75
A15877-100ul 100ul
£192.50
A15877-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15877
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names STAMBPL1; ALMalpha; AMSH-FP; AMSH-LP; bA399O19.2; AMSH-like protease
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-250 of human STAMBPL1 (NP_065850.1).
Reactivity Mouse, Rat
Gene ID 57559
Calculated MW 49kDa/52kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ELKNDLLKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLSEQIDGSALSCFSTHQNNSLLNVFADQPNKSDATNYASHSPPVNRALT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents