STAM Polyclonal AntibodySTAM Polyclonal Antibody
Move your mouse over image or click to enlarge

STAM Polyclonal Antibody

Cat# Size Price Qty Buy
A4198-200ul 200ul
£332.50
A4198-100ul 100ul
£192.50
A4198-50ul 50ul
£113.75
A4198-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4198
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names STAM; STAM-1; STAM1; signal transducing adaptor molecule
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human STAM (NP_003464.1).
Reactivity Human, Mouse, Rat
Gene ID 8027
Calculated MW 44kDa/59kDa
Observed MW 70kDa
Physical Appearance liquid
Purification Affinity purification
Sequence KNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQH
Sensitivity WB,1:200 - 1:1000|IHC,1:20 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents