SSC4D Polyclonal AntibodySSC4D Polyclonal Antibody
Move your mouse over image or click to enlarge

SSC4D Polyclonal Antibody

Cat# Size Price Qty Buy
A15957-20ul 20ul
£77.00
A15957-50ul 50ul
£113.75
A15957-100ul 100ul
£192.50
A15957-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15957
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SSC4D; S4D-SRCRB; SRCRB-S4D; SRCRB4D; scavenger receptor cysteine rich family member with 4 domains
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 446-575 of human SSC4D (NP_542782.1).
Reactivity Human, Mouse, Rat
Gene ID 136853
Calculated MW 29kDa/60kDa
Observed MW 61kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PEELGLQVQQDGSETTRVPTPRPRDGHLRLVNGAHRCEGRVELYLGQRWGTVCDDAWDLRAAGVLCRQLGCGQALAAPGEAHFGPGRGPILLDNVKCRGEESALLLCSHIRWDAHNCDHSEDASVLCQPS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents