SRSF2 Polyclonal AntibodySRSF2 Polyclonal Antibody
Move your mouse over image or click to enlarge

SRSF2 Polyclonal Antibody

Cat# Size Price Qty Buy
A3635-200ul 200ul
£332.50
A3635-100ul 100ul
£192.50
A3635-50ul 50ul
£113.75
A3635-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3635
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SRSF2; PR264; SC-35; SC35; SFRS2; SFRS2A; SRp30b; serine/arginine-rich splicing factor 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human SRSF2 (NP_003007.2).
Reactivity Human, Mouse, Rat
Gene ID 6427
Calculated MW 24kDa/25kDa
Observed MW 28kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAM
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents