SRRM2 Polyclonal AntibodySRRM2 Polyclonal Antibody
Move your mouse over image or click to enlarge

SRRM2 Polyclonal Antibody

Cat# Size Price Qty Buy
A15993-20ul 20ul
£77.00
A15993-50ul 50ul
£113.75
A15993-100ul 100ul
£192.50
A15993-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15993
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SRRM2; 300-KD; CWF21; Cwc21; HSPC075; SRL300; SRm300; serine/arginine repetitive matrix 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRRM2 (NP_057417.3).
Reactivity Human, Mouse, Rat
Gene ID 23524
Calculated MW 34kDa/256kDa/299kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MYNGIGLPTPRGSGTNGYVQRNLSLVRGRRGERPDYKGEEELRRLEAALVKRPNPDILDHERKRRVELRCLELEEMMEEQGYEEQQIQEKVATFRLMLLE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents