SRP9 Polyclonal AntibodySRP9 Polyclonal Antibody
Move your mouse over image or click to enlarge

SRP9 Polyclonal Antibody

Cat# Size Price Qty Buy
A4124-200ul 200ul
£332.50
A4124-100ul 100ul
£192.50
A4124-50ul 50ul
£113.75
A4124-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4124
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SRP9; ALURBP; signal recognition particle 9
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SRP9 (NP_003124.1).
Reactivity Human
Gene ID 6726
Calculated MW 9kDa/10kDa
Observed MW 12kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE
Sensitivity WB,1:1000 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents