SRP54 Polyclonal AntibodySRP54 Polyclonal Antibody
Move your mouse over image or click to enlarge

SRP54 Polyclonal Antibody

Cat# Size Price Qty Buy
A4126-200ul 200ul
£332.50
A4126-100ul 100ul
£192.50
A4126-50ul 50ul
£113.75
A4126-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4126
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SRP54; signal recognition particle 54
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 196-455 of human SRP54 (NP_001139754.1).
Reactivity Human, Mouse
Gene ID 6729
Calculated MW 50kDa/55kDa
Observed MW 56kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGMMGFNNM
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents