SREK1 Polyclonal AntibodySREK1 Polyclonal Antibody
Move your mouse over image or click to enlarge

SREK1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13235-200ul 200ul
£332.50
A13235-100ul 100ul
£192.50
A13235-50ul 50ul
£113.75
A13235-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13235
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SREK1; SFRS12; SRrp508; SRrp86; splicing regulatory glutamine/lysine-rich protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SREK1 (NP_631907.1).
Reactivity Human
Gene ID 140890
Calculated MW 59kDa/71kDa
Observed MW 59kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAAALDPNIATLGEIPQPPLMGNVDPSKIDEIRRTVYVGNLNSQTTTADQLLEFFKQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPLKINHSNNAIVKPPEMTPQAAAKELEEVMKRVREAQSFISAAIEPE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents