SPSB1 Polyclonal AntibodySPSB1 Polyclonal Antibody
Move your mouse over image or click to enlarge

SPSB1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13886-200ul 200ul
£332.50
A13886-100ul 100ul
£192.50
A13886-50ul 50ul
£113.75
A13886-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13886
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SPSB1; SSB-1; SSB1; SPRY domain-containing SOCS box protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human SPSB1 (NP_079382.2).
Reactivity Human, Mouse, Rat
Gene ID 80176
Calculated MW 30kDa
Observed MW 31kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNND
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents