SPDEF Polyclonal AntibodySPDEF Polyclonal Antibody
Move your mouse over image or click to enlarge

SPDEF Polyclonal Antibody

Cat# Size Price Qty Buy
A14114-200ul 200ul
£332.50
A14114-100ul 100ul
£192.50
A14114-50ul 50ul
£113.75
A14114-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14114
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SPDEF; PDEF; bA375E1.3; SAM pointed domain-containing Ets transcription factor
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-335 of human SPDEF (NP_036523.1).
Reactivity Human, Mouse, Rat
Gene ID 25803
Calculated MW 35kDa/37kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI
Sensitivity WB,1:500 - 1:1000|IHC,1:50 - 1:200|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents