SPATA7 Polyclonal AntibodySPATA7 Polyclonal Antibody
Move your mouse over image or click to enlarge

SPATA7 Polyclonal Antibody

Cat# Size Price Qty Buy
A14285-200ul 200ul
£332.50
A14285-100ul 100ul
£192.50
A14285-50ul 50ul
£113.75
A14285-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14285
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SPATA7; HEL-S-296; HSD-3.1; HSD3; LCA3; spermatogenesis associated 7
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-599 of human SPATA7 (NP_060888.2).
Reactivity Human, Mouse, Rat
Gene ID 55812
Calculated MW 51kDa/64kDa/67kDa
Observed MW 75kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDSLTDRETSVNVIEGDSDPEKVEISNGLCGLNTSPSQSVQFSSVKGDNNHDMELSTLKIMEMSIEDCPLDV
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents