SPA17 Polyclonal AntibodySPA17 Polyclonal Antibody
Move your mouse over image or click to enlarge

SPA17 Polyclonal Antibody

Cat# Size Price Qty Buy
A4769-200ul 200ul
£332.50
A4769-100ul 100ul
£192.50
A4769-50ul 50ul
£113.75
A4769-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4769
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SPA17; CT22; SP17; SP17-1; sperm surface protein Sp17
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-151 of human SPA17 (NP_059121.1).
Reactivity Human, Mouse, Rat
Gene ID 53340
Calculated MW 17kDa
Observed MW 17kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents