SNRPD3 Polyclonal AntibodySNRPD3 Polyclonal Antibody
Move your mouse over image or click to enlarge

SNRPD3 Polyclonal Antibody

Cat# Size Price Qty Buy
A16070-20ul 20ul
£77.00
A16070-50ul 50ul
£113.75
A16070-100ul 100ul
£192.50
A16070-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16070
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SNRPD3; SMD3; Sm-D3; small nuclear ribonucleoprotein Sm D3
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 8-121 of human SNRPD3 (NP_001265585).
Reactivity Human, Mouse, Rat
Gene ID 6634
Calculated MW 13kDa
Observed MW 14kDa
Physical Appearance liquid
Purification Affinity purification
Sequence KVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNI
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents