SLITRK6 Polyclonal AntibodySLITRK6 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLITRK6 Polyclonal Antibody

Cat# Size Price Qty Buy
A3521-200ul 200ul
£332.50
A3521-100ul 100ul
£192.50
A3521-50ul 50ul
£113.75
A3521-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3521
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLITRK6; DFNMYP; SLIT and NTRK-like protein 6
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 621-816 of human SLITRK6 (NP_115605.2).
Reactivity Human, Mouse, Rat
Gene ID 84189
Calculated MW 95kDa
Observed MW 120kDa
Physical Appearance liquid
Purification Affinity purification
Sequence IVFCAAGIVVLVLHRRRRYKKKQVDEQMRDNSPVHLQYSMYGHKTTHHTTERPSASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKEGSDAKHLQRSLLEQENHSPLTGSNMKYKTTNQSTEFLSFQDASSLYRNILEKERELQQLGITEYLRKNIAQLQPDMEAHYPGAHEELKLMETLMYSRPRKVLVEQT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents