SLC7A11 Polyclonal AntibodySLC7A11 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC7A11 Polyclonal Antibody

Cat# Size Price Qty Buy
A13685-200ul 200ul
£332.50
A13685-100ul 100ul
£192.50
A13685-50ul 50ul
£113.75
A13685-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13685
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC7A11; CCBR1; xCT; cystine/glutamate transporter
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SLC7A11 (NP_055146.1).
Reactivity Human, Mouse, Rat
Gene ID 23657
Calculated MW 55kDa
Observed MW 37kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWF
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents