SLC6A2 Polyclonal AntibodySLC6A2 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC6A2 Polyclonal Antibody

Cat# Size Price Qty Buy
A1421-200ul 200ul
£332.50
A1421-100ul 100ul
£192.50
A1421-50ul 50ul
£113.75
A1421-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1421
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC6A2; NAT1; NET; NET1; SLC6A5; solute carrier family 6 member 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human SLC6A2 (NP_001165975.1).
Reactivity Human, Mouse, Rat
Gene ID 6530
Calculated MW 57kDa/69kDa/70kDa
Observed MW 69kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLAPRDGDAQPRETWGKKIDFLLSVV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents