SLC5A6 Polyclonal AntibodySLC5A6 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC5A6 Polyclonal Antibody

Cat# Size Price Qty Buy
A13904-200ul 200ul
£332.50
A13904-100ul 100ul
£192.50
A13904-50ul 50ul
£113.75
A13904-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13904
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC5A6; SMVT; solute carrier family 5 member 6
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 546-635 of human SLC5A6 (NP_066918.2).
Reactivity Human
Gene ID 8884
Calculated MW 68kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SLLTGRMRGRSLNPATIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL
Sensitivity IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents