SLC52A3 Polyclonal AntibodySLC52A3 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC52A3 Polyclonal Antibody

Cat# Size Price Qty Buy
A15935-20ul 20ul
£77.00
A15935-50ul 50ul
£113.75
A15935-100ul 100ul
£192.50
A15935-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15935
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC52A3; BVVLS; BVVLS1; C20orf54; RFT2; RFVT3; bA371L19.1; hRFT2; solute carrier family 52 member 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC52A3 (NP_212134.3).
Reactivity Mouse
Gene ID 113278
Calculated MW 45kDa/50kDa
Observed MW 51kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PGMEAPLSHLESRYLPAHFSPLVFFLLLSIMMACCLVAFFVLQRQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKAAPCCPAHL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents