SLC4A10 Polyclonal AntibodySLC4A10 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC4A10 Polyclonal Antibody

Cat# Size Price Qty Buy
A13810-200ul 200ul
£332.50
A13810-100ul 100ul
£192.50
A13810-50ul 50ul
£113.75
A13810-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13810
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC4A10; NBCn2; NCBE; solute carrier family 4 member 10
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 640-725 of human SLC4A10 (NP_001171486.1).
Reactivity Human, Mouse
Gene ID 57282
Calculated MW 46kDa/122kDa/123kDa/125kDa
Observed MW 180kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ALEKLFELSEAYPINMHNDLELLTQYSCNCVEPHNPSNGTLKEWRESNISASDIIWENLTVSECKSLHGEYVGRACGHDHPYVPDV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents