SLC47A1 Polyclonal AntibodySLC47A1 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC47A1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14559-200ul 200ul
£332.50
A14559-100ul 100ul
£192.50
A14559-50ul 50ul
£113.75
A14559-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14559
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC47A1; MATE1; solute carrier family 47 member 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 460-550 of human SLC47A1 (NP_060712.2).
Reactivity Human, Rat
Gene ID 55244
Calculated MW 31kDa/61kDa/63kDa
Observed MW 62kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LNWKKACQQAQVHANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQLVLRRGLLL
Sensitivity WB,1:500 - 1:1000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents