SLC39A6 Polyclonal AntibodySLC39A6 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC39A6 Polyclonal Antibody

Cat# Size Price Qty Buy
A4584-200ul 200ul
£332.50
A4584-100ul 100ul
£192.50
A4584-50ul 50ul
£113.75
A4584-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4584
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC39A6; LIV-1; ZIP6; zinc transporter ZIP6
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 170-320 of human SLC39A6 (NP_001092876.1).
Reactivity Human, Mouse, Rat
Gene ID 25800
Calculated MW 48kDa/85kDa
Observed MW 102kDa
Physical Appearance liquid
Purification Affinity purification
Sequence KQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKVDTDDRTEGYLRADSQEPSHFDSQQPAVLEEEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDDLIHHHHDYHHILHHHHHQNHHPHSHSQRYSREELKDAGVATL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents