SLC38A3 Polyclonal AntibodySLC38A3 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC38A3 Polyclonal Antibody

Cat# Size Price Qty Buy
A4472-200ul 200ul
£332.50
A4472-100ul 100ul
£192.50
A4472-50ul 50ul
£113.75
A4472-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4472
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC38A3; G17; NAT1; SN1; SNAT3; solute carrier family 38 member 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human SLC38A3 (NP_006832.1).
Reactivity Human, Mouse, Rat
Gene ID 10991
Calculated MW 55kDa
Observed MW 60kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEAPLQTEMVELVPNGKHSEGLLPVITPMAGNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents