SLC2A5 Polyclonal AntibodySLC2A5 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC2A5 Polyclonal Antibody

Cat# Size Price Qty Buy
A13650-200ul 200ul
£332.50
A13650-100ul 100ul
£192.50
A13650-50ul 50ul
£113.75
A13650-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13650
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC2A5; GLUT-5; GLUT5; solute carrier family 2 member 5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC2A5 (NP_003030.1).
Reactivity Human, Mouse
Gene ID 6518
Calculated MW 26kDa/54kDa
Observed MW 65kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGEFMEDFPLTLLWSVTVSMFPFGGFIGSLLVGPLVNKFGRKG
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents