SLC26A2 Polyclonal AntibodySLC26A2 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC26A2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14561-200ul 200ul
£332.50
A14561-100ul 100ul
£192.50
A14561-50ul 50ul
£113.75
A14561-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14561
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC26A2; D5S1708; DTD; DTDST; EDM4; MST153; MSTP157; sulfate transporter
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human SLC26A2 (NP_000103.2).
Reactivity Human, Mouse, Rat
Gene ID 1836
Calculated MW 81kDa
Observed MW 82kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLKKNILGD
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents