SLC25A23 Polyclonal AntibodySLC25A23 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC25A23 Polyclonal Antibody

Cat# Size Price Qty Buy
A14352-200ul 200ul
£332.50
A14352-100ul 100ul
£192.50
A14352-50ul 50ul
£113.75
A14352-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14352
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC25A23; APC2; MCSC2; SCaMC-3; solute carrier family 25 member 23
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human SLC25A23 (NP_077008.2).
Reactivity Human, Mouse, Rat
Gene ID 79085
Calculated MW 48kDa/49kDa/52kDa/54kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHS
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents