SLC20A1 Polyclonal AntibodySLC20A1 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC20A1 Polyclonal Antibody

Cat# Size Price Qty Buy
A4117-200ul 200ul
£332.50
A4117-100ul 100ul
£192.50
A4117-50ul 50ul
£113.75
A4117-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4117
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC20A1; GLVR1; Glvr-1; PIT1; PiT-1; solute carrier family 20 member 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 257-356 of human SLC20A1 (NP_005406.3).
Reactivity Human, Mouse, Rat
Gene ID 6574
Calculated MW 73kDa
Observed MW 70-100kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 30867423
Sequence KIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNGAVQLPN
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents