SLC18A3 Polyclonal AntibodySLC18A3 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC18A3 Polyclonal Antibody

Cat# Size Price Qty Buy
A16068-20ul 20ul
£77.00
A16068-50ul 50ul
£113.75
A16068-100ul 100ul
£192.50
A16068-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16068
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC18A3; CMS21; VACHT; solute carrier family 18 member A3
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human SLC18A3 (NP_003046.2).
Reactivity Human, Mouse, Rat
Gene ID 6572
Calculated MW 56kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVLVIVCVALLLDNMLYMVIVPIVPDYIAHMRGGGEGPTRTPEVWEPTLPLPTPANASAYTANTSASPTAAWPAGSALRPRYPTESEDVKIGVLFASKAILQLLVNPLSGPFIDRMS
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents