SLC17A6 Polyclonal AntibodySLC17A6 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC17A6 Polyclonal Antibody

Cat# Size Price Qty Buy
A13648-200ul 200ul
£332.50
A13648-100ul 100ul
£192.50
A13648-50ul 50ul
£113.75
A13648-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13648
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC17A6; DNPI; VGLUT2; vesicular glutamate transporter 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human SLC17A6 (NP_065079.1).
Reactivity Mouse, Rat
Gene ID 57084
Calculated MW 64kDa
Observed MW 64kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents