SLC16A4 Polyclonal AntibodySLC16A4 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC16A4 Polyclonal Antibody

Cat# Size Price Qty Buy
A3016-200ul 200ul
£332.50
A3016-100ul 100ul
£192.50
A3016-50ul 50ul
£113.75
A3016-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3016
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC16A4; MCT4; MCT5; monocarboxylate transporter 5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human SLC16A4 (NP_004687.1).
Reactivity Human, Mouse
Gene ID 9122
Calculated MW 35kDa/42kDa/46kDa/49kDa/54kDa
Observed MW 54kDa
Physical Appearance liquid
Purification Affinity purification
Sequence KNLTVSQNQSEEFYNGPNRNRLLLKSDEESDKVISWSCKQLFDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDIMDASYLVSVAGILETVS
Sensitivity WB,1:1000 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents