SLC16A2 Polyclonal AntibodySLC16A2 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC16A2 Polyclonal Antibody

Cat# Size Price Qty Buy
A3636-200ul 200ul
£332.50
A3636-100ul 100ul
£192.50
A3636-50ul 50ul
£113.75
A3636-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3636
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC16A2; AHDS; DXS128; DXS128E; MCT 7; MCT 8; MCT7; MCT8; MRX22; XPCT; monocarboxylate transporter 8
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC16A2 (NP_006508.2).
Reactivity Human, Mouse, Rat
Gene ID 6567
Calculated MW 59kDa
Observed MW 70kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPDPAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents