SKAP1 Polyclonal AntibodySKAP1 Polyclonal Antibody
Move your mouse over image or click to enlarge

SKAP1 Polyclonal Antibody

Cat# Size Price Qty Buy
A3345-200ul 200ul
£332.50
A3345-100ul 100ul
£192.50
A3345-50ul 50ul
£113.75
A3345-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3345
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SKAP1; HEL-S-81p; SCAP1; SKAP55; src kinase-associated phosphoprotein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-358 of human SKAP1 (NP_001068567.1).
Reactivity Mouse, Rat
Gene ID 8631
Calculated MW 41kDa
Observed MW 55kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLKDLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYLTTAFEVEER
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents