SIGLEC9 Polyclonal AntibodySIGLEC9 Polyclonal Antibody
Move your mouse over image or click to enlarge

SIGLEC9 Polyclonal Antibody

Cat# Size Price Qty Buy
A4648-200ul 200ul
£332.50
A4648-100ul 100ul
£192.50
A4648-50ul 50ul
£113.75
A4648-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4648
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SIGLEC9; CD329; CDw329; FOAP-9; OBBP-LIKE; siglec-9; sialic acid-binding Ig-like lectin 9
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 210-340 of human SIGLEC9 (NP_001185487.1).
Reactivity Human, Mouse, Rat
Gene ID 27180
Calculated MW 50kDa/52kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SLTCQVTFPGASVTTNKTVHLNVSYPPQNLTMTVFQGDGTVSTVLGNGSSLSLPEGQSLRLVCAVDAVDSNPPARLSLSWRGLTLCPSQPSNPGVLELPWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSK
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents