SIGLEC5 Polyclonal AntibodySIGLEC5 Polyclonal Antibody
Move your mouse over image or click to enlarge

SIGLEC5 Polyclonal Antibody

Cat# Size Price Qty Buy
A4250-200ul 200ul
£332.50
A4250-100ul 100ul
£192.50
A4250-50ul 50ul
£113.75
A4250-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4250
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SIGLEC5; CD170; CD33L2; OB-BP2; OBBP2; SIGLEC-5; sialic acid-binding Ig-like lectin 5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 452-551 of human SIGLEC5 (NP_003821.1).
Reactivity Human
Gene ID 8778
Calculated MW 60kDa
Observed MW 140kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ICLCLIFFLIVKARRKQAAGRPEKMDDEDPIMGTITSGSRKKPWPDSPGDQASPPGDAPPLEEQKELHYASLSFSEMKSREPKDQEAPSTTEYSEIKTSK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents