SH2D1B Polyclonal AntibodySH2D1B Polyclonal Antibody
Move your mouse over image or click to enlarge

SH2D1B Polyclonal Antibody

Cat# Size Price Qty Buy
A16010-50ul 50ul
£113.75
A16010-20ul 20ul
£77.00
A16010-200ul 200ul
£332.50
A16010-100ul 100ul
£192.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16010
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SH2D1B; EAT2; SH2 domain containing 1B
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-132 of human SH2D1B (NP_444512.2).
Reactivity Human
Gene ID 117157
Calculated MW 9kDa/15kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents